PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000262990
Common NameLOC103425475
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 279aa    MW: 32169 Da    PI: 7.4878
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000262990genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.31.5e-5391341128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+++yLk +++++++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nrat sgyWkatg+dk+++s +
  MDP0000262990   9 LPPGFRFHPTDEELIMFYLKYQATSRPCPV-SIIPEVDIYKFDPWELPEKAEFGENEWYFFTPRDRKYPNGIRPNRATVSGYWKATGTDKAIYS-E 102
                    79****************************.89***************99999*****************************************.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ vg+kk Lvfy+gr pkg+k+dW+mheyrl
  MDP0000262990 103 SKYVGVKKALVFYQGRPPKGVKSDWIMHEYRL 134
                    99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-654162IPR003441NAC domain
PROSITE profilePS5100560.3239162IPR003441NAC domain
PfamPF023658.4E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEAKQSSQLP PGFRFHPTDE ELIMFYLKYQ ATSRPCPVSI IPEVDIYKFD PWELPEKAEF  60
GENEWYFFTP RDRKYPNGIR PNRATVSGYW KATGTDKAIY SESKYVGVKK ALVFYQGRPP  120
KGVKSDWIMH EYRLGDTRKQ QANKQLGSMR LDDWVLCRIY KKRQPGKAYL DXKVEEDEKI  180
EMTTPETAKX NEEQMMLKFP RTCSITSLLD MDYLGPMSQL LGDNNSGYDF QSSLAGAGAG  240
HAQMFQFGEM PNYQTTTDSG KFQAMAQTNV LNHQPWFGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-7121648170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.98590.0fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981270.0KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008361781.10.0PREDICTED: NAC transcription factor 29-like
RefseqXP_008368238.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-112NAC29_ARATH; NAC transcription factor 29
TrEMBLD9ZJA90.0D9ZJA9_MALDO; NAC domain class transcription factor
STRINGPOPTR_0008s08850.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-114NAC-like, activated by AP3/PI